General Information

  • ID:  hor002527
  • Uniprot ID:  A0A0D9SF12
  • Protein name:  N-Tyr-MIF-1
  • Gene name:  CCDC163
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  YPLG
  • Length:  4(30-33)
  • Propeptide:  MNTSLSWFEQLDVLLNATDGNVVRNKQWLYPLGVSTELIGLCICFFCSSGCIFLGSPPQNSTAVTPAVLWEESEIMQKELKLLQYQLSQHQELLLKQLAEGRQAQVGSWKIPRGAPFLTWSPASFSSMPRVLSKRTYSFGAPKCS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0D9SF12-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002527_AF2.pdbhor002527_ESM.pdb

Physical Information

Mass: 50221 Formula: C22H32N4O6
Absent amino acids: ACDEFHIKMNQRSTVW Common amino acids: GLPY
pI: 6.09 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 1
Hydrophobicity: 12.5 Boman Index: 572
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: 3835 Extinction Coefficient cystines: 1490
Absorbance 280nm: 496.67

Literature

  • PubMed ID:  8105102
  • Title:  Endogenous Peptide Tyr-Pro-Trp-Gly-NH2 (Tyr-W-MIF-1) Is Transported From the Brain to the Blood by Peptide Transport system-1